PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G25850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 302aa    MW: 33927.5 Da    PI: 8.168
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G25850.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.8e-51141521128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkk...lelee............vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                      lppGfrFhP+d+elv +yL++k+ +                      v+ +vd++k+ePwdLp+ +  + kewyf+s rd+kyatg+r+nrat+
  OGLUM06G25850.1  14 LPPGFRFHPRDDELVLDYLERKLLDGGvggA---AaaaaavtiygcpVMVDVDLNKCEPWDLPEIACVGGKEWYFYSLRDRKYATGQRTNRATE 104
                      79*********************99996651...23445667788878***************7666689************************ PP

              NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      sgyWkatgkd+++ + kg lvg++ktLvfykgrapkg+kt+Wvmhe+r 
  OGLUM06G25850.1 105 SGYWKATGKDRPISR-KGLLVGMRKTLVFYKGRAPKGKKTEWVMHEFRK 152
                      *************99.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-594175IPR003441NAC domain
PROSITE profilePS5100553.89514175IPR003441NAC domain
PfamPF023652.2E-2515151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MSGMNSLSMV EARLPPGFRF HPRDDELVLD YLERKLLDGG VGGAAAAAAA VTIYGCPVMV  60
DVDLNKCEPW DLPEIACVGG KEWYFYSLRD RKYATGQRTN RATESGYWKA TGKDRPISRK  120
GLLVGMRKTL VFYKGRAPKG KKTEWVMHEF RKEGQGDPMK LPLKEDWVLC RVFYKSRTTK  180
LPTEGSYNNI DSVATTSLPP LTDNYIAFDQ PGSMQNLEGY EQVPCFSNNP SQQPSSSMNV  240
PLTSAMVDQE QNNMGRAIKD VLSQFTKFEG NVKREALRSN FSQDGFDYLA ESGFTQMWNS  300
LS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-491017611169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0636480.0AK063648.1 Oryza sativa Japonica Group cDNA clone:001-119-A03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643121.10.0PREDICTED: NAC domain-containing protein 21/22
RefseqXP_015643122.10.0PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE61e-90NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0E0AD750.0A0A0E0AD75_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g46270.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-89NAC domain containing protein 1